How to Be a Better DM: Dungeon Master Tips for the DM Newbie, the Hobbyist and the Forever DM

Justin Lewis
undefined
Jun 9, 2022 • 30min

Essential Sections of the D&D Dungeon Master's Guide

Here are today's sponsors:Worldsmith - Easy D&D Prep - Start a Free 7 Day Trial: https://session0studios.com/worldsmith-podcastRoll and Play Press - Easier D&D: https://session0studios.com/rollandplayStudio Fantasms: https://session0studios.com/fantasmsOur Patreon: https://session0studios.com/patreonWarmupDescribe the coolest water fight you can think of.IntroWelcome back to How to Be a Better DMJustin's Favorite SectionsApparently endless magic itemsDaerns Instant Fortress is a cool item I’ve read about recently.I also like the Bag of TricksCreating settlements, castles, cities, etc.Learning about the different planesDifferent Governments for example Plutocracy - Governed by the wealthy who buy ruling seatsBonus: The Hand and Eye of VecnaTanner's Favorite SectionsBoring Rules… Jk, super important:Don’t check during a session, if you can help it. Prep, and then come back after the session to check up on rules you may have gotten wrong.Chapters 8 and 9 (have all sorts of weird rules to check)Background noise: https://www.youtube.com/watch?v=NCSJwAHKV4QSpecial thanks to:Benj Weyland for Graphic Design (https://www.instagram.com/benjweydesign/)TJ Max, Juka, and TechSenpai for being amazing moderatorsKyle Wilson, Nick Ammann and Professor Nobody for being our patrons.Mentioned in this episode:Brought to you by Session 0 StudiosVisit session0studios.com for more information.Add the Magic of Sound to Your GameplayWhen you set the scene you need to tap into the five senses. When it comes to sound one of the best ways to do that is with music, sound effects, and ambience. That’s why we’ve teamed up with Monument Studios. Monument Studios provides an easy-to-use Soundboard perfect for Dungeon Mastering. If you want to see this in action, go to fantasy-plus.com and get 10% off of your first month of their Fantasy+ App by using the code BETTERDM at check out. Again that is fantasy-plus.com and BETTERDM at checkout. Monument StudiosDo You Want to Earn some Money?🎲 Want to Earn Some Extra Gold? We’re offering a referral incentive for our professional Dungeon Mastering services! Here’s how it works: 1️⃣ Refer someone to session0studios.com/prodm 2️⃣ They sign up for a free consultation. 3️⃣ They mention they were referred by a podcast listener. 4️⃣ We DM an unforgettable session for them. 5️⃣ They get 10% off their booking. 6️⃣ You get 10% of what they paid—straight into your coin purse. 7️⃣ We celebrate with a virtual high-five. 🙌 We run games for private groups and corporate teams—whether it’s a one-shot or a long-term campaign. 💰 Want to earn some gold and help someone level up their game night? Send them to session0studios.com/prodm and start earning today!Give Us a Rating and ReviewYou obviously have really good taste, you’re listening to How to Be a Better DM after all. We thank you for your support. If you’ve ever gotten anything useful from our show, take a minute to give us a rating and a review. It goes a very long way to making it so How to Be a Better DM can help many more dungeon masters just like you. If you love our content, help others become better dungeon masters too.
undefined
Jun 2, 2022 • 17min

How to Make D&D More Immersive

Here are today's sponsors:Worldsmith - Easy D&D Prep - Start a Free 7 Day Trial: https://session0studios.com/worldsmith-podcastRoll and Play Press - Easier D&D: https://session0studios.com/rollandplayStudio Fantasms: https://session0studios.com/fantasmsOur Patreon: https://session0studios.com/patreonYou sit down at the fire. You’ve traveled a long distance to reach these particular nomads. You’ve heard tell that these nomads have mystical powers and can guide you on finding unknowable secrets. You look around. Their long arms show a fierce exterior, but they’ve let you sit in their circle. They’ve shared their meat with you. Their hair hides their faces though you can see pinpricks of light reflect off of their eyes and hidden behind their hair. They seem to look at you expectantly.“Um… what am I…”It’s at that moment that one of their numbers starts beating a drum produced from somewhere within the folds of their outer garments. More drums are produced and the rhythm continues and amplifies. Soon the sound of beating drums is all you hear. It echoes the beating of a heart. Not your heart but the communal heart of this tribe.You let yourself fall into the rhythm. After a moment, you notice an elder stand up and walk towards the central fire. He chants some things and then throws some dust into the fire. There’s a puff of green smoke and you smell a distinct earthy smell. Soon, your senses become slurred and you seem to drift from reality.Your eyes open and instead of at a ritual fire, you’re standing waist-deep in the ocean. You look over and see another tribal member standing with you. You both wield spears and look for fish. You throw your spear. Flash.Instead of being near a ritual fire, you’re crouching low in a snowy copse of trees. You peer out from behind some bushes and see an auroch munching on greenery. The rest of your hunting party has snuck around to flank the beast. You hear the double hoot of an owl. That’s the signal. You jump up and charge to attack the beast.Flash.Instead of at a ritual fire, you’re in a grotto. You see a large stone monolith. Inscribed on the giant stone are ancient runes. They glow softly blue in the dim light. At the base of the monolith is a pool of water that seems pure and as you approach it starts to glow light blue. This is what you’ve come for.So what would you like to do?Welcome back to another episode of How to Be a Better DM. I’m your host Justin Lewis and together you and I will learn how to tell better stories as we DM sessions of Dungeons and Dragons 5e. First of all, I’ve got to say thank you so much. Since we started the show, we’ve seen amazing growth that I never could have predicted. It’s all because of you guys. You guys have allowed us to create cool content and spread it to some awesome people.Next don’t forget to listen to the end of today’s episode to hear how you can support the show.Today, let’s talk about immersion. Now, I’m not going to be talking about Virtual Reality, though we can all expect that within our lifetimes we’ll see all sorts of leaps in bounds in that area.No, I’m talking about learning to help your players feel like they are in your world. You have to help your players slip the bonds of our time and space and instead drift through the planes to the material plane on which you play D&D.Better descriptionsNo amount of cool voice-changing software or LED lights will cover up bad storytelling. Storytelling is character, plot, voice, and conflict. It’s also scene. You need to be able to paint pictures with your words. Work on your descriptions of all points of your gameplay. There’s a fine balancing act here though. You can’t take forever describing something but you also shouldn’t do it in just one word. You need to be concise and evocative. It’s helpful to describe things using your senses. Don’t forget that sixth sense we all get. You know like when there’s tension in the air and no one is saying anything but you can feel that something is wrong.One thing I’d recommend steering away from that is somewhat a crutch is using analogies from our world. I struggle with this because it’s so helpful and easy but I think it pulls your players out of the world you’re describing when you compare something to a thing that exists in the real world. Know the LoreI know you thought you were done studying after you graduated high school or college but it makes things feel real when your player asks an NPC a question and the NPC can respond almost immediately. There’s something magical when you as the dungeon master know the names and major players in the plot and you don’t have to immediately reference the guidebook to remember that the villain's henchman’s name is Botheg and that Botheg loves to eat silver spotted mushrooms that allow him to have very special dreams at night. If you’re an advanced dungeon master, you can do better than that.Seamless ExperiencesKnow what you’re going to do every session. I completely understand having to take a minute to make up an entire encounter that you didn’t plan on. We’ve all been there. But you can at least put in the effort to make sure the encounters you did plan on are seamless. Part of it is making sure you’ve understood the sequence of events. Another part is making sure you have the NPCs lined up. A final part is going through all of this in your head so you aren’t constantly checking notes and stammering, “One second.” It takes practice of course, but this is the standard you want to set for yourself.Voice ChangingWhile being one of the most common things most of us do while driving to work in the morning… No… just me? Anyways, changing your voice to fit your NPCs can go a long way to helping your players immerse themselves into the game. A quick Youtube search will give you many results for tips and tutorials on how to actually make your voice change in a convincing way. Another option is acting lessons. Most of us wrote off acting when we were younger. Now we spend a lot of time watching professional actors on TV and think, “maybe it wasn’t good to brush that off.”Better RoleplayingI know that most of us feel awkward roleplaying. We grew up playing make-believe and then for some reason we stepped away from it. It felt childish to pretend to be someone we’re not. So we stopped. We hid it. We found that we do funny voices and accents while we’re alone in our car driving to or from work, but we never do that in front of someone else. Or if we do, it’s never in a structured way, it’s just fun.  Let me tell you, roleplaying can make or break the immersion. There have been times when I’ve paused and said, “What would they say?” because I didn’t know what a particular NPC would say. The momentum halted and the mood broke. There have been other times when I’ve thrown caution to the wind and said something somewhat ridiculous but I committed and I felt that the table enjoyed the risk. So when you sit at your table, try and step into the role of the character you are playing. Try being an actor for a second. It’s ok. You won’t be perfect and no one will judge you. If they do, just add 10 hitpoints to their next encounter.Mood LightingThis one is admittedly low on the list of things you should do to make your game more immersive. Mood lighting can be an awesome way to, well, get your players in the mood. It also can become a distraction if you make it really complicated. I would say keep it simple stupid and set something up and leave it for a while to see how it works before changing it over and over and over.Remove DistractionsThis is a tough one specifically for those of us who like to use our phones for managing our character. You need to make a rule at the table that everyone’s main focus will be on the game. There are always extenuating circumstances but for the most part, removing distractions is an easy and in my opinion necessary step to achieving the nirvana of a gameplay experience. It gets very old looking up from my DM screen and seeing certain players scrolling on their phones rather than engaging in the game. I also do appreciate the fact that my wife uses a paper character sheet. She says she prefers it, but I think it has something to do with her knowing that being on her phone would be distracting.The Occasional Real LIfe PropWhile a most costly method of immersion, popping out the occasional prop can help your players transcend their natural bonds and reach an elevated space of gameplay. When your characters buy a map it can drastically change the way they play when you hand them a real-life map to be sure. Again, this is more costly in terms of time and money, but it could be just the juice you need to spice things up. PracticeNothing beats practice. Period. No amount of cool props or amazing voices will cover for the fact that your story is garbage. If you can’t tell a story, you can’t make up for it. At least not in the long run. So first things first are if nothing else, start playing D&D. You need to at least get in the habit of role-playing. The next step after that is to start DMing. Find a group where you can experiment and try things out. What you are looking for is iteration and repetition rather than one-and-done experiences.True Mastery of Plot CraftingAlmost nothing can cover up a bad plot. Your players will never enjoy a bad or boring story, no matter how many cool doodads you have. So spend time working on the main tenets of a plot. Improve the conflicts, twists and tension, and resolution. You can’t expect your players to enjoy or immerse themselves in a story that you truly aren’t immersed in or crazy about.There you have it, 10 ways to make your DND Campaign more immersive. Thanks for listening to today’s episode. Make sure to stick around after to hear some announcements but until next time, Let’s roll initiative.Music from https://www.youtube.com/watch?v=tCBCLYvWGwISpecial thanks to:Benj Weyland for Graphic Design (https://www.instagram.com/benjweydesign/)TJ Max, Juka, and TechSenpai for being amazing moderatorsKyle Wilson, Nick Ammann and Professor Nobody for being our patrons.Mentioned in this episode:Do You Want to Earn some Money?🎲 Want to Earn Some Extra Gold? We’re offering a referral incentive for our professional Dungeon Mastering services! Here’s how it works: 1️⃣ Refer someone to session0studios.com/prodm 2️⃣ They sign up for a free consultation. 3️⃣ They mention they were referred by a podcast listener. 4️⃣ We DM an unforgettable session for them. 5️⃣ They get 10% off their booking. 6️⃣ You get 10% of what they paid—straight into your coin purse. 7️⃣ We celebrate with a virtual high-five. 🙌 We run games for private groups and corporate teams—whether it’s a one-shot or a long-term campaign. 💰 Want to earn some gold and help someone level up their game night? Send them to session0studios.com/prodm and start earning today!Brought to you by Session 0 StudiosVisit session0studios.com for more information.Give Us a Rating and ReviewYou obviously have really good taste, you’re listening to How to Be a Better DM after all. We thank you for your support. If you’ve ever gotten anything useful from our show, take a minute to give us a rating and a review. It goes a very long way to making it so How to Be a Better DM can help many more dungeon masters just like you. If you love our content, help others become better dungeon masters too.Add the Magic of Sound to Your GameplayWhen you set the scene you need to tap into the five senses. When it comes to sound one of the best ways to do that is with music, sound effects, and ambience. That’s why we’ve teamed up with Monument Studios. Monument Studios provides an easy-to-use Soundboard perfect for Dungeon Mastering. If you want to see this in action, go to fantasy-plus.com and get 10% off of your first month of their Fantasy+ App by using the code BETTERDM at check out. Again that is fantasy-plus.com and BETTERDM at checkout. Monument Studios
undefined
May 26, 2022 • 36min

How to Make a Dynamic Campaign with Garrett from Two25 Games

Game developer Garrett from two25games.com discusses how to make a story and campaign dynamic. Topics include introducing instruments based on different cultural flavors, perception and character development, balancing player dynamics in a DnD campaign, and the importance of variety and investment in dynamic campaigns.
undefined
May 19, 2022 • 19min

Ideas for Campaign First Sessions

Here are today's sponsors:Worldsmith - Easy D&D Prep - Start a Free 7 Day Trial: https://session0studios.com/worldsmith-podcastRoll and Play Press - Easier D&D: https://session0studios.com/rollandplayStudio Fantasms: https://session0studios.com/fantasmsOur Patreon: https://session0studios.com/patreonThis is How To Be A Better DM. Today we will discussing the Why and What of campaign first sessions.Thanks for listening to today’s show! My name is Tanner Weyland, and I am excited to talk about how we can all prepare to be the best DMs we possible. We really appreciate all the support you guys give us. If you’d like to hang out with us once a month, you can. All you gotta do is sign up for our monthly one-shot D&D sessions which are DM’d by one of us. It’s first come first serve so sign up quick. This month I am running the session, and I am very excited for it! The sign up link is: https://how-to-be-a-better-dm.captivate.fm/one-shotNext, make sure to sign up for our monthly newsletter. You’ll get even more content, behind-the-scenes looks, homebrew creations made by us and more. It’s free and it comes out once a month so it won’t be a bother to you. Sign up at: https://how-to-be-a-better-dm.captivate.fm/subscribeSpecial thanks to:Benj Weyland for Graphic Design (https://www.instagram.com/benjweydesign/)TJ Max, Juka, and TechSenpai for being amazing moderatorsKyle Wilson, Nick Ammann and Professor Nobody for being our patrons.Mentioned in this episode:Give Us a Rating and ReviewYou obviously have really good taste, you’re listening to How to Be a Better DM after all. We thank you for your support. If you’ve ever gotten anything useful from our show, take a minute to give us a rating and a review. It goes a very long way to making it so How to Be a Better DM can help many more dungeon masters just like you. If you love our content, help others become better dungeon masters too.Start Leveling Up As a DMWouldn’t it be nice to gamify your dungeon master abilities? In D&D, characters can reach level 20, so why can’t dungeon masters? We’re happy to tell you that now, you can. We created the Dungeon Master Level-Up Guide. It’s a simple tool to gamify your progression to higher and higher levels of dungeon mastering. It includes Dungeon Master Levels 1 to 20 with associated XP requirements as well as a long list of Dungeon Master activities that will give you XP. Each activity has a Challenge Rating and an XP amount. In order to level up, all you need to do is find out how much XP you have, find out how much you need and pick activities to try. You can get the Dungeon Master Level-Up guide for free by going to session0studios.com/newsletter/, sign up for our newsletter and we’ll email you the Level-Up Guide. Finally, leveling up as a DM can be as fun as leveling up a character. Level Up GuideWhy Listen to Ads?Ugh, another ad break. Let’s be real—ads are the worst. If you’re anything like my wife, you’d rather quit a show entirely than sit through another ad. So why suffer? Just skip them. Join our Patreon at patreon.com/betterdungeonmaster and enjoy ad-free episodes with exclusive patron-only content—all for just $5 a month. Look at you, all fancy with your uninterrupted listening experience. So stop wasting time on ads (like this one). Go to patreon.com/betterdungeonmaster and upgrade your listening today!PatreonBrought to you by Session 0 StudiosVisit session0studios.com for more information.
undefined
May 12, 2022 • 26min

Preparing for Your First D&D Session

Here are today's sponsors:Worldsmith - Easy D&D Prep - Start a Free 7 Day Trial: https://session0studios.com/worldsmith-podcastRoll and Play Press - Easier D&D: https://session0studios.com/rollandplayStudio Fantasms: https://session0studios.com/fantasmsOur Patreon: https://session0studios.com/patreonWarmup: From JustinIntroWelcomeThanks for the One-Shot with Dan, Jordan and Anna. We really appreciate your support. We will be having our next one-shot at the end of this month.Make sure to sign up for the newsletter as well.As well if you’re interested in us livestreaming this particular segment of our show, then let us know, reach out to us on our Instagram or email. We can even do an ask me anything. If that’s something you’re interested in, let us know.Topic: Preparing for your First D&D SessionJustinRun ThroughBefore I do my session, I find it’s incredibly helpful just to quickly run through the session or at least what I’ve written about it and my timeline. More than anything this just help refresh in my mind the basic timeline of things. I feel it makes a difference to my players when I know that C happens after B and D happens after C and A is how it all starts.Prepare the SpaceGM SetupPlayer Character SheetsMinisSnacksSpecific Text Write UpsBeginning of the GameVery Specific Parts of the game that will give maximum impactLook Up or Create Helpful TablesHelpful loot tablesRandom encounter tablesRead the LoreYou want to make sure you know at least a brief idea of some things that happen next.TannerBe Simple: plan something straightforward and simple. Exploring, simple dungeon or house exploration can be a wonderful way to start an adventure since it is low on mechanics, has the excitement of discovery, and does not require intense role playing by you.Have a Dry Run (for online): if it is your first time running D&D, have one of your players come early to run through technical difficulties (if they are friends, this should not be too hard).Plan One NPC as a warm-up: role-playing well on your first session is very nerve-wracking, and it can make you shy away from doing serious role-playing, like voices and the whole shebang. So, I would suggest planning a throwaway NPC to help you transition into it. And make them exaggerated: super old, or super gruff, or super British-orphan, or whatever! Just something you can be silly with, but also something you have to put yourself out there for.ClosingBackground noise: https://www.youtube.com/watch?v=NCSJwAHKV4QSpecial thanks to:Benj Weyland for Graphic Design (https://www.instagram.com/benjweydesign/)TJ Max, Juka, and TechSenpai for being amazing moderatorsKyle Wilson, Nick Ammann and Professor Nobody for being our patrons.Mentioned in this episode:Give Us a Rating and ReviewYou obviously have really good taste, you’re listening to How to Be a Better DM after all. We thank you for your support. If you’ve ever gotten anything useful from our show, take a minute to give us a rating and a review. It goes a very long way to making it so How to Be a Better DM can help many more dungeon masters just like you. If you love our content, help others become better dungeon masters too.Brought to you by Session 0 StudiosVisit session0studios.com for more information.Why Listen to Ads?Ugh, another ad break. Let’s be real—ads are the worst. If you’re anything like my wife, you’d rather quit a show entirely than sit through another ad. So why suffer? Just skip them. Join our Patreon at patreon.com/betterdungeonmaster and enjoy ad-free episodes with exclusive patron-only content—all for just $5 a month. Look at you, all fancy with your uninterrupted listening experience. So stop wasting time on ads (like this one). Go to patreon.com/betterdungeonmaster and upgrade your listening today!PatreonStart Leveling Up As a DMWouldn’t it be nice to gamify your dungeon master abilities? In D&D, characters can reach level 20, so why can’t dungeon masters? We’re happy to tell you that now, you can. We created the Dungeon Master Level-Up Guide. It’s a simple tool to gamify your progression to higher and higher levels of dungeon mastering. It includes Dungeon Master Levels 1 to 20 with associated XP requirements as well as a long list of Dungeon Master activities that will give you XP. Each activity has a Challenge Rating and an XP amount. In order to level up, all you need to do is find out how much XP you have, find out how much you need and pick activities to try. You can get the Dungeon Master Level-Up guide for free by going to session0studios.com/newsletter/, sign up for our newsletter and we’ll email you the Level-Up Guide. Finally, leveling up as a DM can be as fun as leveling up a character. Level Up Guide
undefined
May 5, 2022 • 10min

How to Find Your D&D Group

You walk into the tavern. Your sword and shield clinking together as you walk makes everyone in the tavern turn and look at you. Being somewhat new to this you try and act tough and scowl at everyone. It doesn’t come off well and you look sort of foolish. You walk over to the bar and wait patiently for the bartender to come talk to you and ask you what you want to drink. He doesn’t. Instead he serves all the other patrons who keep shouting at him. “It seems the squeaky wheel does get the grease,” you mutter under your breath. You raise your hand and shout at the bartender and finally he comes over. He’s a large half-orc fellow who looks like he’s no stranger to a brawl.“Heyo, what’ll it be?” He asks with a quizzical eye at your armor and clothing.You brush it off and say, “A simple ale please, and I was wondering if you could give me some direction?” The bartender stops and gives you more of his full attention. “Yeah? What did you need?”“Well, I’m looking for sort of a group of companions. Do you know any mercenary groups that are open to a new member?”The half-orc smiles and says, “you must be new to this whole adventuring thing. Well these groups don’t just accept complete strangers in. You’ll have to prove yourself and they don’t really go about looking for new compatriots.  Now, with that in mind,” and he turns you to look at the rest of the tavern, “over in that corner, yeah those dark elves, they are the Right Harvesters. They’re a group of crow come up from the Underdark seeking the quell those who follow any demon or devil. Bunch of rightoues pricks you ask me. Over there with the ogre, they’re the Blade Speakers. Mostly just ruffians and vagabonda really. Lastly, the group to your left here are the Whisper Wraiths. They’re tied up with the Zhentarim pretty tight. So adventurer, here’s your drink and I’m mighty curious what you’re going to do.”So what would you like to do?Welcome back to How to Be a Better DM. I’m your host, Justin Lewis and I’m here to help you create better stories as you DM sessions of Dungeons and Dragons 5e.Today, let’s talk about one of the first things that you’ll do as a DM- finding your D&D group.This is going to be my hypothetical list for what I’d do if I wanted to find players for my D&D campaign. You might try different things, but this is what I would do first.Ask friends and familyThe first thing I do when starting a D&D campaign is ask my friends and family. For me personally, I try to start with my family just to build that relationship better but that’s just me. I also don’t just ask friends who I know would be interested. I ask any friend because D&D is a great way to build friendships. I’ve also been highly surprised at the people who’ve said yes and have even been extremely excited to try D&D. You just gotta ask. I think this is the best place to start because D&D can turn an acquaintance into a friend and a good relationship into a great one. Often D&D sessions turn into much more. Ask Friends and Family for ReferralsEvery single one of your friends has friends who are not your friends. What better way to meet someone who might like the same types of things you like than by asking someone who likes the same types of things that you like? “But I don’t really want to meet new people…”I get it. We’re all introverts and we’re all extroverts and we all like staying home and binging Netflix and we all like going out and partying. Sometimes you don’t want to meet new people, but sometimes you don’t want to be lonely. The fact of the matter is that you do have to put yourself out there, especially as a DM. You have to give so many invitations and most of them will naturally be no’s. That’s ok. Just ask your friends and family who say no who they might know who would say yes or even be interested in hearing what D&D is all about.Trawl the SocialsThe next thing I do is head over to the social media Lords and bow down before them begging for the gift of friendship. Just kidding, but seriously, the social media palaces are great places to find new adventurers. There are basically two methods of approach.The Craigslist MethodThis method isn’t as productive as the next method I think. Virtually, you go online and you post essentially a want-ad. In fact here’s a quick template that you can use:Hi, I’m looking for anyone interested in trying something new.There’s a game that I’ve been wanting to play for a while (called Dungeons and Dragons). I’d love to try it out with you. If you’re interested, send me a quick DM.The parentheses are optional but you just put out your desires to the universe and let the universe get back to you. I’ve done this and it’s worked pretty well, but not as well as I would have hoped.The Spy MethodInstead of sending out an advertisement on a feed that most people won’t see or will disregard, there’s a better way. Naturally, this way will take a lot more work and intelligence, but you’ll get better results.Start with the list of people you follow or who follow you on the social media platform of your choice. Now go down the list one by one. Look through their photos and posts and look for something that would indicate that they’d be open to playing D&D with you. Next, send them a simple direct message about what you noticed on their profile and then ask if they’d be interested in playing. You’re looking for signals that they’d be receptive to the invitation.Hit Up Local Comic Book StoresNext, you can try frequenting places where the type of person you’re looking for frequents. Go to your local game store or comic book store. I know here in Utah county we have Dragon’s Keep, the Game Grid, the Gamer’s Inn, and a few more. Go there and hang around for a while. You can try sparking up a conversation with anyone perusing the D&D section of the store. If you’re too afraid of doing that you can ask the person at the front counter if they know of anyone looking for a D&D group. They’ll likely have some sort of resource available or just know someone who’s asked them the same question. They’ll be able to put you in touch. Browse OnlineNext, you can look through sites like Roll20 for a group. You can also put yourself up on sites like startplaying.games where you can list games that you’d like to host as a DM. This option really works the best when you have a lot of experience and lots of compelling images that catch people’s attention and draw them in. The other way is to play as a player in one of these settings and then ask the other players if they’d be up for playing again but with you in the DM seat. Make sure not to steal the group away from the original DM or there may be bad blood.Craigslist AdWhen everything else fails you can just post a free ad on Craigslist or wherever there are classifieds and hope for a response. To be honest, I would not even try this method because you will likely get responses from a lot of creepy people. Instead, reach out to us on Instagram @howtobeabetterdm and we’d be happy to try and set you up in a group with anyone we know. We don’t have a huge community of friends and peers but we’d be happy to open it up to you so you don’t have to keep looking through Craigslist.Thanks for listening to today’s show. Stay tuned after to hear some announcements but until next time my friend, let’s roll initiative.Music from https://www.youtube.com/watch?v=pgLjYsVP4H0&t=36sMentioned in this episode:Start Leveling Up As a DMWouldn’t it be nice to gamify your dungeon master abilities? In D&D, characters can reach level 20, so why can’t dungeon masters? We’re happy to tell you that now, you can. We created the Dungeon Master Level-Up Guide. It’s a simple tool to gamify your progression to higher and higher levels of dungeon mastering. It includes Dungeon Master Levels 1 to 20 with associated XP requirements as well as a long list of Dungeon Master activities that will give you XP. Each activity has a Challenge Rating and an XP amount. In order to level up, all you need to do is find out how much XP you have, find out how much you need and pick activities to try. You can get the Dungeon Master Level-Up guide for free by going to session0studios.com/newsletter/, sign up for our newsletter and we’ll email you the Level-Up Guide. Finally, leveling up as a DM can be as fun as leveling up a character. Level Up GuideWhy Listen to Ads?Ugh, another ad break. Let’s be real—ads are the worst. If you’re anything like my wife, you’d rather quit a show entirely than sit through another ad. So why suffer? Just skip them. Join our Patreon at patreon.com/betterdungeonmaster and enjoy ad-free episodes with exclusive patron-only content—all for just $5 a month. Look at you, all fancy with your uninterrupted listening experience. So stop wasting time on ads (like this one). Go to patreon.com/betterdungeonmaster and upgrade your listening today!PatreonGive Us a Rating and ReviewYou obviously have really good taste, you’re listening to How to Be a Better DM after all. We thank you for your support. If you’ve ever gotten anything useful from our show, take a minute to give us a rating and a review. It goes a very long way to making it so How to Be a Better DM can help many more dungeon masters just like you. If you love our content, help others become better dungeon masters too.Brought to you by Session 0 StudiosVisit session0studios.com for more information.
undefined
Apr 28, 2022 • 23min

Our Favorite Dungeon Master Enemies (For Now)

Welcome back to another episode of How to Be a Better DM.Today Tanner and Justin talk about their favorite enemies!Today's music was provided by https://www.youtube.com/watch?v=roABNwbjZf4Mentioned in this episode:Brought to you by Session 0 StudiosVisit session0studios.com for more information.Why Listen to Ads?Ugh, another ad break. Let’s be real—ads are the worst. If you’re anything like my wife, you’d rather quit a show entirely than sit through another ad. So why suffer? Just skip them. Join our Patreon at patreon.com/betterdungeonmaster and enjoy ad-free episodes with exclusive patron-only content—all for just $5 a month. Look at you, all fancy with your uninterrupted listening experience. So stop wasting time on ads (like this one). Go to patreon.com/betterdungeonmaster and upgrade your listening today!PatreonStart Leveling Up As a DMWouldn’t it be nice to gamify your dungeon master abilities? In D&D, characters can reach level 20, so why can’t dungeon masters? We’re happy to tell you that now, you can. We created the Dungeon Master Level-Up Guide. It’s a simple tool to gamify your progression to higher and higher levels of dungeon mastering. It includes Dungeon Master Levels 1 to 20 with associated XP requirements as well as a long list of Dungeon Master activities that will give you XP. Each activity has a Challenge Rating and an XP amount. In order to level up, all you need to do is find out how much XP you have, find out how much you need and pick activities to try. You can get the Dungeon Master Level-Up guide for free by going to session0studios.com/newsletter/, sign up for our newsletter and we’ll email you the Level-Up Guide. Finally, leveling up as a DM can be as fun as leveling up a character. Level Up GuideGive Us a Rating and ReviewYou obviously have really good taste, you’re listening to How to Be a Better DM after all. We thank you for your support. If you’ve ever gotten anything useful from our show, take a minute to give us a rating and a review. It goes a very long way to making it so How to Be a Better DM can help many more dungeon masters just like you. If you love our content, help others become better dungeon masters too.
undefined
Apr 21, 2022 • 16min

How To Deal With "That One Player"

Welcome back to How to Be a Better DM. I’m one of your hosts, Tanner Weyland, and together you and I will learn how to tell better stories as we DM sessions of Dungeons and Dragons 5e.Today I share my thoughts on how to communicate with "that one player." Difficult interpersonal issues are often solved with open and constructive communication.If you like the podcast today, or if you have suggestions for future podcasts, connect with us on our new instagram @howtobeabetterdm and let us know!Would you like to play D&D with us? If so, then sign up for the newsletter and get access to monthly sign ups for a session with me or one of the other hosts. Sign up at https://how-to-be-a-better-dm.captivate.fm/subscribeMentioned in this episode:Why Listen to Ads?Ugh, another ad break. Let’s be real—ads are the worst. If you’re anything like my wife, you’d rather quit a show entirely than sit through another ad. So why suffer? Just skip them. Join our Patreon at patreon.com/betterdungeonmaster and enjoy ad-free episodes with exclusive patron-only content—all for just $5 a month. Look at you, all fancy with your uninterrupted listening experience. So stop wasting time on ads (like this one). Go to patreon.com/betterdungeonmaster and upgrade your listening today!PatreonGive Us a Rating and ReviewYou obviously have really good taste, you’re listening to How to Be a Better DM after all. We thank you for your support. If you’ve ever gotten anything useful from our show, take a minute to give us a rating and a review. It goes a very long way to making it so How to Be a Better DM can help many more dungeon masters just like you. If you love our content, help others become better dungeon masters too.Brought to you by Session 0 StudiosVisit session0studios.com for more information.Get The Swampberry Moonshine Jamboree For FreeTake a trip down to the bayou in The Swampberry Moonshine Jamboree. We teamed up with Studio Fantasms to bring you a raucous one-shot adventure full of gatorfolk, catfishing, and a whole lotta moonshine. We wrote the adventure, they designed the minis—it’s a sweet little bundle, and it’s totally free for the month of May. Just head to https://session0studios.com/fantasms and sign up to grab it. Don’t wait—May’s free, and once it’s gone, it’s gone.
undefined
Apr 14, 2022 • 26min

Our Preferred Dungeon Master Setup

It's another duo-show with Justin and Tanner.Listen afterward for a note from our sponsor.Mentioned in this episode:Give Us a Rating and ReviewYou obviously have really good taste, you’re listening to How to Be a Better DM after all. We thank you for your support. If you’ve ever gotten anything useful from our show, take a minute to give us a rating and a review. It goes a very long way to making it so How to Be a Better DM can help many more dungeon masters just like you. If you love our content, help others become better dungeon masters too.Brought to you by Session 0 StudiosVisit session0studios.com for more information.Why Listen to Ads?Ugh, another ad break. Let’s be real—ads are the worst. If you’re anything like my wife, you’d rather quit a show entirely than sit through another ad. So why suffer? Just skip them. Join our Patreon at patreon.com/betterdungeonmaster and enjoy ad-free episodes with exclusive patron-only content—all for just $5 a month. Look at you, all fancy with your uninterrupted listening experience. So stop wasting time on ads (like this one). Go to patreon.com/betterdungeonmaster and upgrade your listening today!PatreonGet The Swampberry Moonshine Jamboree For FreeTake a trip down to the bayou in The Swampberry Moonshine Jamboree. We teamed up with Studio Fantasms to bring you a raucous one-shot adventure full of gatorfolk, catfishing, and a whole lotta moonshine. We wrote the adventure, they designed the minis—it’s a sweet little bundle, and it’s totally free for the month of May. Just head to https://session0studios.com/fantasms and sign up to grab it. Don’t wait—May’s free, and once it’s gone, it’s gone.
undefined
Apr 7, 2022 • 8min

Tips on Describing Combat in D&D

You fall to one knee. The large orc in front of you grips his battle ax firmly in his hands and lets out a mocking grunt. Blood drips down the blade and onto the ground. Your blood.You look around at your companions. They are all lying on the ground bloody and unconscious. Julian might be dead. Things could not look worse. “Puny wizard. Drinking your blood will be a great pleasure.” The orc says through his tusked maw.You slowly raise yourself to your feet and point at the orc with a shaking finger. “Blood for blood. This death was brought to pass by your actions feral one.” The orc begins to laugh. Then he charges you. You reach inside your tunic and pull out a simple wand of cherry wood. You point it at the orc and whisper, “Infiern”. Immediately a brilliant ball of fire is launched from the wands’ tip expanding to engulfing the entire orc. Unfortunately, you are also a bit to close to the fire and find yourself flung off your feet as the ball of flames explodes on impact with the goblinoid.You open your eyes to see everything on fire, even you, but you can’t seem to move.What would you like to do?Welcome back to How to be a Better DM. I’m your host Justin Lewis and together, you and I will learn how to craft better stories as we DM sessions of Dungeons and Dragons 5e.As always, I’m very grateful that you’ve allowed me to dig into the hobby for 8 months now and we don’t plan on stopping. You guys have been stellar in showing us what you like and what you don’t like and we will do everything we can to gratify your desires.If there’s one thing that a lot of people struggle with, it’s describing combat. Honestly, it can be hard for any DM to make round after round after round of combat interesting. There’s a spectrum. It goes from very boring combat to perhaps too graphic and violent. So how do you describe D&D combat in the best way? This is how.HighlightsD&D is not a movie. As much as we treat it like a movie, even going to the point of using Screen Wipes as happens in tabletop games like Star Wars, it’s not a movie. In movies, you can show every single moment of action, because in reality it only takes a couple seconds. When you use words to describe every single action in combat it takes much longer. That’s because two things can happen simultaneously in real life but you can only say one word at a time. So with your combat, describe the highlights. Briefly describe the effect of an attack that does damage. Don’t go deep into, “You swing and miss and they swing and miss and back and forth and finally someone scores a hit.” That’s too much. You can even just give the damage and save the juicy descriptions for large amounts of damage or the end.Realistic combatIf you’re fighting someone who is proficient with a weapon and you don’t kill them in the first hit, then that means that most of your hits do not sever limbs or slash deep gouges. Sometimes you need to be realistic in the way that you describe things. Just because you do damage mechanically doesn’t mean that you have to necessarily do damage in your narrative. Say a barbarian does 12 points of slashing damage with their battle ax. You could describe that as the ax cutting deep into the enemy’s armor, slowly deteriorating its integrity, allowing for an opening that becomes pivotal when a crucial opportunity presents itself. You don’t have to be lopping off people’s arms with every swing.Describe the Bigger BaddiesOften in D&D, your villains will have minions. If in the same combat encounter you have a multitude of minions, then don’t waste too much extra breath on the mini baddies when you can describe the big baddies in much better detail. You don’t have to explain that the skeleton chopped when you can spend much more time describing what the Lich did. No one cares about the skeletons (for the most part). Follow the Flow of CombatCombat is a story just like any other part of D&D. It has crescendos and decrescendos. The more combat seems to be difficult, the more you should indulge in describing the combat to enhance the tension. If a player is sustaining many serious wounds, then you should describe that. If the characters are decimating foes left and right, you don’t need to go into too much detail.Narrate evenly for everyoneThough it might be more fun to describe how the wizard pulls out his wand of fireball and unleashes hell than it is to say that the rogue takes a shot on their crossbow, you should look for ways to spice it up evenly between both players.  Give everyone a chance to feel awesome.Learn specific verbs, adverbs and adjectivesVerbs are what someone does, adverbs is how they do it and adjectives describe the effect on the subject of their verb. Here’s a small table with some words every DM should be able to useVerbAdverbAdjectiveslashnoiselesslybloodysmashquicklybruisedsliceloudlycoldparrypainfullytiredstabwearilyexhaustedcutstronglyshakingbludgeonconfidentlysweatycharweaklytousledblackendeathlydisheveledimpalehopefullygrimIt’s not a full list of words to use but it should get your brain thinking.The Simple FormulaIt’s ok to use a one sentence formula as well. Try thisYou [adverb] [verb] your [enemy] with your [adjective] [weapon].This could look like:You weakly char your orcish foe with your fiery Wand of Fireballs.Simple.Now that’s not an exhaustive course on describing D&D combat. I don’t have an english degree by the way, but that should get you far enough to be able to help you players feel more immersed and really make a big difference in your narration.Make sure to stick around after to hear some announcements and the show’s sponsors, but until next time, let’s roll initiative.Mentioned in this episode:Get The Swampberry Moonshine Jamboree For FreeTake a trip down to the bayou in The Swampberry Moonshine Jamboree. We teamed up with Studio Fantasms to bring you a raucous one-shot adventure full of gatorfolk, catfishing, and a whole lotta moonshine. We wrote the adventure, they designed the minis—it’s a sweet little bundle, and it’s totally free for the month of May. Just head to https://session0studios.com/fantasms and sign up to grab it. Don’t wait—May’s free, and once it’s gone, it’s gone.Save time with Roll and Play PressSave yourself some precious time with Roll and Play Press. Go to https://session0studios.com/rollandplay and use code BETTERDM10 at checkout.Give Us a Rating and ReviewYou obviously have really good taste, you’re listening to How to Be a Better DM after all. We thank you for your support. If you’ve ever gotten anything useful from our show, take a minute to give us a rating and a review. It goes a very long way to making it so How to Be a Better DM can help many more dungeon masters just like you. If you love our content, help others become better dungeon masters too.Brought to you by Session 0 StudiosVisit session0studios.com for more information.

The AI-powered Podcast Player

Save insights by tapping your headphones, chat with episodes, discover the best highlights - and more!
App store bannerPlay store banner
Get the app